Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAL1 Rabbit Polyclonal Antibody (Biotin)

DNAL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LC1, CILD16, C14orf168

UniProt

Q4LDG9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_113615

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ces2b Protein Vector (Mouse) (pPB-N-His)
PV164895 500 ng

Ces2b Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
LIN28A Antibody
F40207-0.08ML 0.08 mL

LIN28A Antibody

Sign In for Pricing
View Details
FAM214A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV797705 1.0 µg DNA

FAM214A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
UCHL5, ID (UCHL5, UCH37, Ubiquitin carboxyl-terminal hydrolase isozyme L5, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin thioesterase L5) (FITC)
MBS6361061-01 0.2 mL

UCHL5, ID (UCHL5, UCH37, Ubiquitin carboxyl-terminal hydrolase isozyme L5, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin thioesterase L5) (FITC)

Sign In for Pricing
View Details
UCHL5, ID (UCHL5, UCH37, Ubiquitin carboxyl-terminal hydrolase isozyme L5, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin thioesterase L5) (FITC)
MBS6361061-02 5x 0.2 mL

UCHL5, ID (UCHL5, UCH37, Ubiquitin carboxyl-terminal hydrolase isozyme L5, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin thioesterase L5) (FITC)

Sign In for Pricing
View Details
Mini Dry Bath Incubator (BDMI-107)
BDMI-107 1 Unit

Mini Dry Bath Incubator (BDMI-107)

Sign In for Pricing
View Details