Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHI3L2 Rabbit Polyclonal Antibody (Biotin)

CHI3L2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CHIL2, YKL39, YKL-39

UniProt

Q15782

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_003991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Commd10 (NM_178377) Mouse Untagged Clone
MC207683 10 µg

Commd10 (NM_178377) Mouse Untagged Clone

Sign In for Pricing
View Details
PHLDA2, CT (PHLDA2, BWR1C, HLDA2, IPL, TSSC3, Pleckstrin homology-like domain family A member 2, Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein, Imprinted in placenta and liver protein, Tumor-suppressing STF cDNA 3 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein, p17-Beckwith-Wiedemann region 1 C) (MaxLight 405) discontinued
039962-ML405 100 µL

PHLDA2, CT (PHLDA2, BWR1C, HLDA2, IPL, TSSC3, Pleckstrin homology-like domain family A member 2, Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein, Imprinted in placenta and liver protein, Tumor-suppressing STF cDNA 3 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein, p17-Beckwith-Wiedemann region 1 C) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral human ADGRA1 shRNA (UAS) - Lentiviral human ADGRA1 shRNA (UAS, iRFP) (100)
GTR15080727 1 Vial

Lentiviral human ADGRA1 shRNA (UAS) - Lentiviral human ADGRA1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Monoclonal RNF125 Antibody (monoclonal) (M01), Clone: 1A5
AMM04019G 0.1mg

Monoclonal RNF125 Antibody (monoclonal) (M01), Clone: 1A5

Sign In for Pricing
View Details
LentimiRa-mmu-miR-463-3p Vector
mm40443 500 ng

LentimiRa-mmu-miR-463-3p Vector

Sign In for Pricing
View Details
BRIP1 Polyclonal Antibody
30736-01 50 µL

BRIP1 Polyclonal Antibody

Sign In for Pricing
View Details