Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHI3L2 Rabbit Polyclonal Antibody (FITC)

CHI3L2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CHIL2, YKL39, YKL-39

UniProt

Q15782

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVSAGRQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_003991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Major facilitator superfamily domain-containing protein 4, MFSD4 ELISA Kit
MBS9337306-01 48 Well

Human Major facilitator superfamily domain-containing protein 4, MFSD4 ELISA Kit

Sign In for Pricing
View Details
Human Major facilitator superfamily domain-containing protein 4, MFSD4 ELISA Kit
MBS9337306-02 96 Well

Human Major facilitator superfamily domain-containing protein 4, MFSD4 ELISA Kit

Sign In for Pricing
View Details
Human Major facilitator superfamily domain-containing protein 4, MFSD4 ELISA Kit
MBS9337306-03 5x 96 Well

Human Major facilitator superfamily domain-containing protein 4, MFSD4 ELISA Kit

Sign In for Pricing
View Details
Human Major facilitator superfamily domain-containing protein 4, MFSD4 ELISA Kit
MBS9337306-04 10x 96 Well

Human Major facilitator superfamily domain-containing protein 4, MFSD4 ELISA Kit

Sign In for Pricing
View Details
Collagen IV discontinued
534954-01 30ul

Collagen IV discontinued

Sign In for Pricing
View Details
Collagen IV discontinued
534954-02 100 µL

Collagen IV discontinued

Sign In for Pricing
View Details