Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRINL1A Rabbit Polyclonal Antibody (Biotin)

GRINL1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GCOM1, Gdown, Gdown1, GRINL1A

UniProt

P0CAP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDEDD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056347

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NENF (Neudesin, Cell Immortalization-related Protein 2, Neuron-derived Neurotrophic Factor, Secreted Protein of Unknown Function, SPUF Protein, CIR2, SPUF) (AP) discontinued
130291-AP 100 µL

NENF (Neudesin, Cell Immortalization-related Protein 2, Neuron-derived Neurotrophic Factor, Secreted Protein of Unknown Function, SPUF Protein, CIR2, SPUF) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Rat CD71/TFRC Protein, N-His
RY036011-01 50 µg

Recombinant Rat CD71/TFRC Protein, N-His

Sign In for Pricing
View Details
Recombinant Rat CD71/TFRC Protein, N-His
RY036011-02 100 µg

Recombinant Rat CD71/TFRC Protein, N-His

Sign In for Pricing
View Details
Recombinant Rat CD71/TFRC Protein, N-His
RY036011-03 1 mg

Recombinant Rat CD71/TFRC Protein, N-His

Sign In for Pricing
View Details
CPZ Recombinant Protein (Human)
RP007939 100 µg

CPZ Recombinant Protein (Human)

Sign In for Pricing
View Details
Human SDNSF/MCFD2 Recombinant Protein
PROTQ8NI22-500ug 500 µg

Human SDNSF/MCFD2 Recombinant Protein

Sign In for Pricing
View Details