Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRINL1A Rabbit Polyclonal Antibody (FITC)

GRINL1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GCOM1, Gdown, Gdown1, GRINL1A

UniProt

P0CAP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_056347

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR4A2 (Nuclear Receptor Subfamily 4 group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NR4A2, NOT, NURR1, TINUR) discontinued
224630-01 50 µL

NR4A2 (Nuclear Receptor Subfamily 4 group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NR4A2, NOT, NURR1, TINUR) discontinued

Sign In for Pricing
View Details
NR4A2 (Nuclear Receptor Subfamily 4 group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NR4A2, NOT, NURR1, TINUR) discontinued
224630-02 100 µL

NR4A2 (Nuclear Receptor Subfamily 4 group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NR4A2, NOT, NURR1, TINUR) discontinued

Sign In for Pricing
View Details
HSP105 Rabbit pAb, PerCP-Cy7 conjugated
orb2845513 100 µL

HSP105 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
SLC8A3 Adenovirus (Human)
44291051 1.0 mL

SLC8A3 Adenovirus (Human)

Sign In for Pricing
View Details
ADAP2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
11376126 3x 1.0µg DNA

ADAP2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys12) Polyclonal Antibody
ABP53693-01 30 µL

Histone H4 (Acetyl Lys12) Polyclonal Antibody

Sign In for Pricing
View Details