Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPOCK2 Rabbit Polyclonal Antibody (Biotin)

SPOCK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Testican-2

UniProt

Q92563

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WLSSISQYSGKIKHWNRFRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Signal Transducer And Activator Of Transcription 5A ELISA Kit
MBS720471-01 48 Well

Rat Signal Transducer And Activator Of Transcription 5A ELISA Kit

Sign In for Pricing
View Details
Rat Signal Transducer And Activator Of Transcription 5A ELISA Kit
MBS720471-02 96 Well

Rat Signal Transducer And Activator Of Transcription 5A ELISA Kit

Sign In for Pricing
View Details
Rat Signal Transducer And Activator Of Transcription 5A ELISA Kit
MBS720471-03 5x 96 Well

Rat Signal Transducer And Activator Of Transcription 5A ELISA Kit

Sign In for Pricing
View Details
Rat Signal Transducer And Activator Of Transcription 5A ELISA Kit
MBS720471-04 10x 96 Well

Rat Signal Transducer And Activator Of Transcription 5A ELISA Kit

Sign In for Pricing
View Details
DCP (Des-gamma Carboxyprothrombin) BioAssayTM ELISA Kit (Rat) discontinued
369868-01 48 Tests

DCP (Des-gamma Carboxyprothrombin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
DCP (Des-gamma Carboxyprothrombin) BioAssayTM ELISA Kit (Rat) discontinued
369868-02 96 Tests

DCP (Des-gamma Carboxyprothrombin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details