Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFHR1 Rabbit Polyclonal Antibody (Biotin)

CFHR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H36, CFHL, FHR1, HFL1, HFL2, CFHL1, FHR-1, H36-1, H36-2, CFHL1P, CFHR1P

UniProt

Q03591

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_002104

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 Recombinant Rabbit mAb, HRP conjugated
orb2353746 100 µL

SOX10 Recombinant Rabbit mAb, HRP conjugated

Sign In for Pricing
View Details
Rat GPT2/ALT2 (Alanine aminotransferase 2) ELISA Kit
orb2992036-01 48 Tests

Rat GPT2/ALT2 (Alanine aminotransferase 2) ELISA Kit

Sign In for Pricing
View Details
Rat GPT2/ALT2 (Alanine aminotransferase 2) ELISA Kit
orb2992036-02 96 Tests

Rat GPT2/ALT2 (Alanine aminotransferase 2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Geobacter bemidjiensis UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)
MBS1224687-01 0.02 mg (E-Coli)

Recombinant Geobacter bemidjiensis UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)

Sign In for Pricing
View Details
Recombinant Geobacter bemidjiensis UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)
MBS1224687-02 0.02 mg (Yeast)

Recombinant Geobacter bemidjiensis UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)

Sign In for Pricing
View Details
Recombinant Geobacter bemidjiensis UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)
MBS1224687-03 0.1 mg (E-Coli)

Recombinant Geobacter bemidjiensis UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (lpxC)

Sign In for Pricing
View Details