Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFHR1 Rabbit Polyclonal Antibody (Biotin)

CFHR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H36, CFHL, FHR1, HFL1, HFL2, CFHL1, FHR-1, H36-1, H36-2, CFHL1P, CFHR1P

UniProt

Q03591

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002104

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK32A, NT (STK32A, Serine/threonine-protein kinase 32A, YANK1) (MaxLight 750)
MBS6352069-01 0.1 mL

STK32A, NT (STK32A, Serine/threonine-protein kinase 32A, YANK1) (MaxLight 750)

Sign In for Pricing
View Details
STK32A, NT (STK32A, Serine/threonine-protein kinase 32A, YANK1) (MaxLight 750)
MBS6352069-02 5x 0.1 mL

STK32A, NT (STK32A, Serine/threonine-protein kinase 32A, YANK1) (MaxLight 750)

Sign In for Pricing
View Details
HSH2D Rabbit Polyclonal Antibody (BF680)
orb2522784 100 µL

HSH2D Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Lentiviral human KIAA1191 shRNA (UAS) - Lentiviral human KIAA1191 shRNA (UAS, GFP) (100)
GTR15122277 1 Vial

Lentiviral human KIAA1191 shRNA (UAS) - Lentiviral human KIAA1191 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ENG 3'UTR Luciferase Stable Cell Line
TU006892 1.0 mL

ENG 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ICA1 (Islet Cell Autoantigen 1, 69kD Islet Cell Autoantigen, ICA69, Islet Cell Autoantigen p69, ICAp69, p69) (APC)
128183-APC 100 µL

ICA1 (Islet Cell Autoantigen 1, 69kD Islet Cell Autoantigen, ICA69, Islet Cell Autoantigen p69, ICAp69, p69) (APC)

Sign In for Pricing
View Details