Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFHR1 Rabbit Polyclonal Antibody (HRP)

CFHR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H36, CFHL, FHR1, HFL1, HFL2, CFHL1, FHR-1, H36-1, H36-2, CFHL1P, CFHR1P

UniProt

Q03591

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002104

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement factor 8 beta Rabbit Polyclonal Antibody
orb182656-01 50 μL

Complement factor 8 beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Complement factor 8 beta Rabbit Polyclonal Antibody
orb182656-02 100 µL

Complement factor 8 beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Complement factor 8 beta Rabbit Polyclonal Antibody
orb182656-03 200 µL

Complement factor 8 beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gephyrin (G-6) Alexa Fluor® 594
sc-25311 AF594 200 µg/mL

Gephyrin (G-6) Alexa Fluor® 594

Sign In for Pricing
View Details
Phospho-MYPT1 (Tyr766) Antibody
AF7106-01 100 µL

Phospho-MYPT1 (Tyr766) Antibody

Sign In for Pricing
View Details
Phospho-MYPT1 (Tyr766) Antibody
AF7106-02 200 µL

Phospho-MYPT1 (Tyr766) Antibody

Sign In for Pricing
View Details