Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTROB Rabbit Polyclonal Antibody (FITC)

CNTROB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LIP8, PP1221

UniProt

Q8N137

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CNTROB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EANQLLSTTLPPPNPPAPPAGPSSPGPQEPEKEERRVWTMPPMAVALKPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orange fluorescent protein Protein, Discosoma sp, Recombinant (His Tag)
PO55475E2 50 µg

Orange fluorescent protein Protein, Discosoma sp, Recombinant (His Tag)

Sign In for Pricing
View Details
Recombinant Human RNA binding protein fox-1 homolog 2
MBS1040268-01 0.02 mg (Yeast)

Recombinant Human RNA binding protein fox-1 homolog 2

Sign In for Pricing
View Details
Recombinant Human RNA binding protein fox-1 homolog 2
MBS1040268-02 0.1 mg (Yeast)

Recombinant Human RNA binding protein fox-1 homolog 2

Sign In for Pricing
View Details
Recombinant Human RNA binding protein fox-1 homolog 2
MBS1040268-03 0.02 mg (Baculovirus)

Recombinant Human RNA binding protein fox-1 homolog 2

Sign In for Pricing
View Details
Recombinant Human RNA binding protein fox-1 homolog 2
MBS1040268-04 1 mg (E-Coli)

Recombinant Human RNA binding protein fox-1 homolog 2

Sign In for Pricing
View Details
Recombinant Human RNA binding protein fox-1 homolog 2
MBS1040268-05 0.02 mg (Mammalian-Cell)

Recombinant Human RNA binding protein fox-1 homolog 2

Sign In for Pricing
View Details