Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nploc4 Rabbit Polyclonal Antibody (HRP)

Nploc4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Npl4, AK129375, mKIAA1499

UniProt

P60670

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Nploc4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLKAFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001181952

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M-CSF Recombinant Rabbit Monoclonal Antibody [SU0413]
ET1609-1 100 µL

M-CSF Recombinant Rabbit Monoclonal Antibody [SU0413]

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF647 conjugate, 0.1mg/mL
BNC472843-100 1x 100 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ado Mouse Gene Knockout Kit (CRISPR)
KN500917 1 Kit

Ado Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP5F1D (NM_001687) Human Over-expression Lysate
LC419790 20 µg

ATP5F1D (NM_001687) Human Over-expression Lysate

Sign In for Pricing
View Details
CTSF Antibody (Biotin)
KB-8227-01 50 μL

CTSF Antibody (Biotin)

Sign In for Pricing
View Details
CTSF Antibody (Biotin)
KB-8227-02 100 µL

CTSF Antibody (Biotin)

Sign In for Pricing
View Details