Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF1BP Rabbit Polyclonal Antibody (HRP)

KIF1BP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KBP, Kif1, Kif1bp, mKIAA1279, 0710007C18Rik, 2510003E04Rik

UniProt

Q6ZPU9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Kbp

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVELHKNPEKEPYKSKYGARALLEEVRALLGPAPEDEDEPAADDGPGDQA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DEPTOR/DEPDC6 Antibody [Alexa Fluor 488]
NBP1-49674AF488 0.1 mL

Rabbit Polyclonal DEPTOR/DEPDC6 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Lentiviral human PRRC2B shRNA (UAS) - Lentiviral human PRRC2B shRNA (UAS, iRFP) (25)
GTR15349457 1 Vial

Lentiviral human PRRC2B shRNA (UAS) - Lentiviral human PRRC2B shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-Annexin A10/ANXA10 Antibody Picoband®, APC Conjugate
A13560-1-APC 100 µg/Vial

Anti-Annexin A10/ANXA10 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
N4BP2 rabbit pAb
UB-GEN-11921 100 µL

N4BP2 rabbit pAb

Sign In for Pricing
View Details
EIF5 Rabbit Polyclonal Antibody (HRP)
orb2107748 100 µL

EIF5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Keratin 18 (Phospho-Ser33) Rabbit pAb
E2310077 100 µL

Keratin 18 (Phospho-Ser33) Rabbit pAb

Sign In for Pricing
View Details