Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFDN4 Rabbit Polyclonal Antibody (HRP)

PFDN4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C1, PFD4

UniProt

Q9NQP4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002614

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBB2A Human Pre-designed siRNA Set A
HY-RS15252 1 Set

TUBB2A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
RGD1310852 Protein Vector (Rat) (pPM-C-HA)
39117026 500 ng

RGD1310852 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ELISA Kit For Leptin
E0084b 96 Tests

ELISA Kit For Leptin

Sign In for Pricing
View Details
BRAF Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-63118R-BF594 100 µL

BRAF Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
2-Cyano-1-[4- (trifluoromethyl) phenyl]ethanone
270088-01 500 mg

2-Cyano-1-[4- (trifluoromethyl) phenyl]ethanone

Sign In for Pricing
View Details
2-Cyano-1-[4- (trifluoromethyl) phenyl]ethanone
270088-02 1 g

2-Cyano-1-[4- (trifluoromethyl) phenyl]ethanone

Sign In for Pricing
View Details