Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFDN4 Rabbit Polyclonal Antibody (HRP)

PFDN4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C1, PFD4

UniProt

Q9NQP4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002614

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MERS-CoV S/Spike glycoprotein (RBD) Protein, No tag
orb2966537-01 50 µg

Recombinant MERS-CoV S/Spike glycoprotein (RBD) Protein, No tag

Sign In for Pricing
View Details
Recombinant MERS-CoV S/Spike glycoprotein (RBD) Protein, No tag
orb2966537-02 100 µg

Recombinant MERS-CoV S/Spike glycoprotein (RBD) Protein, No tag

Sign In for Pricing
View Details
Recombinant MERS-CoV S/Spike glycoprotein (RBD) Protein, No tag
orb2966537-03 1 mg

Recombinant MERS-CoV S/Spike glycoprotein (RBD) Protein, No tag

Sign In for Pricing
View Details
Polyclonal Antibody to Sepiapterin Reductase (SPR)
TRV-0003670-01 20 µL

Polyclonal Antibody to Sepiapterin Reductase (SPR)

Sign In for Pricing
View Details
Polyclonal Antibody to Sepiapterin Reductase (SPR)
TRV-0003670-02 100 µL

Polyclonal Antibody to Sepiapterin Reductase (SPR)

Sign In for Pricing
View Details
Polyclonal Antibody to Sepiapterin Reductase (SPR)
TRV-0003670-03 200 µL

Polyclonal Antibody to Sepiapterin Reductase (SPR)

Sign In for Pricing
View Details