Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pitpnc1 Rabbit Polyclonal Antibody (FITC)

Pitpnc1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RDGBB, Dnr411, RDGBB1, RDGB-BE, AI662802, AI851387, mrdgBbeta, rdgB-beta, 1110020B03Rik, 5830436L09Rik, C330017I21Rik

UniProt

Q8K4R4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLPKFSIHIETKYEDNKGSNDSIFDSEAKDLEREVCFIDIACDEIPERYY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_665822

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SGSH Protein, His/GST-tagged
SGSH-695H 10 µg

Recombinant Human SGSH Protein, His/GST-tagged

Sign In for Pricing
View Details
KSHV GPCR (Kaposi's Carcinoma-associated Herpes Virus, KSHV, Human Herpes Virus 8, HHV8)
K6750 100 µg

KSHV GPCR (Kaposi's Carcinoma-associated Herpes Virus, KSHV, Human Herpes Virus 8, HHV8)

Sign In for Pricing
View Details
INSL7 C-Peptide (Human)
035-52A 100 µg

INSL7 C-Peptide (Human)

Sign In for Pricing
View Details
Stx3 Mouse qPCR Primer Pair (NM_152220)
MP216535 200 Reactions

Stx3 Mouse qPCR Primer Pair (NM_152220)

Sign In for Pricing
View Details
GM130 Polyclonal Antibody, APC-Cy7 Conjugated
bs-8155R-APC-Cy7 100 µL

GM130 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Human ZO2 (Tight junction protein ZO-2) ELISA Kit
EH15436 96 Tests

Human ZO2 (Tight junction protein ZO-2) ELISA Kit

Sign In for Pricing
View Details