Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP6R3 Rabbit Polyclonal Antibody (Biotin)

PPP6R3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SAPL, PP6R3, SAPLa, SAPS3, SAP190, C11orf23

UniProt

Q5H9R7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC60 Protein Vector (Rat) (pPM-C-HA)
PV258028 500 ng

CCDC60 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Pongo abelii Palmitoyltransferase ZDHHC5 (ZDHHC5)
MBS7035711-01 0.02 mg

Recombinant Pongo abelii Palmitoyltransferase ZDHHC5 (ZDHHC5)

Sign In for Pricing
View Details
Recombinant Pongo abelii Palmitoyltransferase ZDHHC5 (ZDHHC5)
MBS7035711-02 0.1 mg

Recombinant Pongo abelii Palmitoyltransferase ZDHHC5 (ZDHHC5)

Sign In for Pricing
View Details
Recombinant Pongo abelii Palmitoyltransferase ZDHHC5 (ZDHHC5)
MBS7035711-03 5x 0.1 mg

Recombinant Pongo abelii Palmitoyltransferase ZDHHC5 (ZDHHC5)

Sign In for Pricing
View Details
Pla2g6 3'UTR GFP Stable Cell Line
TU166478 1.0 mL

Pla2g6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Fructose-1,6-bisphosphatase class 1 (fbp)
MBS1224413-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 Fructose-1,6-bisphosphatase class 1 (fbp)

Sign In for Pricing
View Details