Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP6R3 Rabbit Polyclonal Antibody (HRP)

PPP6R3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAPL, PP6R3, SAPLa, SAPS3, SAP190, C11orf23

UniProt

Q5H9R7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Balaenoptera musculus ATP synthase protein 8 (MT-ATP8)
MBS1247591 Inquire

Recombinant Balaenoptera musculus ATP synthase protein 8 (MT-ATP8)

Sign In for Pricing
View Details
Recombinant E.coli lon/Lon protease Protein, N-His
bs-106593P-01 20 µg

Recombinant E.coli lon/Lon protease Protein, N-His

Sign In for Pricing
View Details
Recombinant E.coli lon/Lon protease Protein, N-His
bs-106593P-02 50 µg

Recombinant E.coli lon/Lon protease Protein, N-His

Sign In for Pricing
View Details
Guinea pig Myosin heavy chain (MHC) ELISA Kit
NSL0501Gp 96 Tests

Guinea pig Myosin heavy chain (MHC) ELISA Kit

Sign In for Pricing
View Details
S100A4 (NM_002961) Human Tagged Lenti ORF Clone
RC203035L2 10 µg

S100A4 (NM_002961) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-CBL (Tyr731) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-3089R-PerCP-Cy5.5 100 µL

Phospho-CBL (Tyr731) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details