Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMMECR1 Rabbit Polyclonal Antibody (HRP)

AMMECR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MFHIEN, AMMERC1

UniProt

Q9Y4X0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AMMECR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020751

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Camta2 shRNA (UAS) - Lentiviral mouse Camta2 shRNA (UAS) (25)
GTR15166025 1 Vial

Lentiviral mouse Camta2 shRNA (UAS) - Lentiviral mouse Camta2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Lentiviral mouse Tor3a shRNA (UAS) - Lentiviral mouse Tor3a shRNA (UAS, iRFP) (100)
GTR15207483 1 Vial

Lentiviral mouse Tor3a shRNA (UAS) - Lentiviral mouse Tor3a shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
AHSA1 antibody
70R-15341 0.1 mg

AHSA1 antibody

Sign In for Pricing
View Details
Mouse Anti-Human IgG Fc - Alexa Fluor 532
E51S3336 100 µL

Mouse Anti-Human IgG Fc - Alexa Fluor 532

Sign In for Pricing
View Details
RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (MaxLight 490)
251339-ML490 100 µL

RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (MaxLight 490)

Sign In for Pricing
View Details
MPST CRISPRa sgRNA lentivector (set of three targets)(Human)
30374121 3x 1.0µg DNA

MPST CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details