Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSPRY Rabbit Polyclonal Antibody (HRP)

BSPRY Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ20150

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_060158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein Kinase C Iota ELISA Kit
MBS016617-01 48 Well

Human Protein Kinase C Iota ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Iota ELISA Kit
MBS016617-02 96 Well

Human Protein Kinase C Iota ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Iota ELISA Kit
MBS016617-03 5x 96 Well

Human Protein Kinase C Iota ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Iota ELISA Kit
MBS016617-04 10x 96 Well

Human Protein Kinase C Iota ELISA Kit

Sign In for Pricing
View Details
Defb9 Protein Vector (Mouse) (pPB-C-His)
PV171606 500 ng

Defb9 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Nqo1 protein
orb604966-01 20 µg

Mouse Nqo1 protein

Sign In for Pricing
View Details