Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16orf57 Rabbit Polyclonal Antibody (Biotin)

C16orf57 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PN, Mpn1, HVSL1, hUsb1, C16orf57

UniProt

Q9BQ65

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Heart Whole Tissue Lysate (Adult Whole Lupus) - (Dry Ice)
NB820-59347 1 mg

Human Heart Whole Tissue Lysate (Adult Whole Lupus) - (Dry Ice)

Sign In for Pricing
View Details
Srrm1 Antibody - C-terminal region
ARP40607_P050-25UL 25 µL

Srrm1 Antibody - C-terminal region

Sign In for Pricing
View Details
CRIP3 Adenovirus (Mouse)
16833054 1.0 mL

CRIP3 Adenovirus (Mouse)

Sign In for Pricing
View Details
Azide Dextrose Broth, Granulated
GM345-500G 500 g

Azide Dextrose Broth, Granulated

Sign In for Pricing
View Details
Embryology and development of animals. - 10 prepared slides in box
59-5170 28 x 20 x 5 cm

Embryology and development of animals. - 10 prepared slides in box

Sign In for Pricing
View Details
Slc25a28 Rat shRNA Lentiviral Particle (Locus ID 688811)
TL708001V 500 µL Each

Slc25a28 Rat shRNA Lentiviral Particle (Locus ID 688811)

Sign In for Pricing
View Details