Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif3d Rabbit Polyclonal Antibody (HRP)

Eif3d Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Eif3s7

UniProt

Q6AYK8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001004283

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-Ethyl-α- (1-demethylethyl) -Verapamil Hydrochloride
469385-01 2.5 mg

α-Ethyl-α- (1-demethylethyl) -Verapamil Hydrochloride

Sign In for Pricing
View Details
α-Ethyl-α- (1-demethylethyl) -Verapamil Hydrochloride
469385-02 5 mg

α-Ethyl-α- (1-demethylethyl) -Verapamil Hydrochloride

Sign In for Pricing
View Details
Guinea pig INS (Insulin) ELISA Kit
EGP27155 96 Tests

Guinea pig INS (Insulin) ELISA Kit

Sign In for Pricing
View Details
Myelin Protein Zero (Myelin Protein P0, MPZ, P0, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Peripheral Protein, MPP) (MaxLight 750)
MBS6234006-01 0.1 mL

Myelin Protein Zero (Myelin Protein P0, MPZ, P0, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Peripheral Protein, MPP) (MaxLight 750)

Sign In for Pricing
View Details
Myelin Protein Zero (Myelin Protein P0, MPZ, P0, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Peripheral Protein, MPP) (MaxLight 750)
MBS6234006-02 5x 0.1 mL

Myelin Protein Zero (Myelin Protein P0, MPZ, P0, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Peripheral Protein, MPP) (MaxLight 750)

Sign In for Pricing
View Details
Zebrafish PSMD13 Rabbit Polyclonal Antibody (Fluoro550)
orb3089738 100 µg

Zebrafish PSMD13 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details