Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3D Rabbit Polyclonal Antibody (FITC)

EIF3D Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EIF3S7, eIF3-p66, eIF3-zeta

UniProt

O15371

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003744

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CCDC102B Protein - (Dry Ice)
H00079839-P01-25ug 25 µg

Recombinant Human CCDC102B Protein - (Dry Ice)

Sign In for Pricing
View Details
HIP1 (Huntingtin-interacting Protein 1, Huntingtin-interacting Protein I, MGC126506) (AP) discontinued
127860-AP 100 µL

HIP1 (Huntingtin-interacting Protein 1, Huntingtin-interacting Protein I, MGC126506) (AP) discontinued

Sign In for Pricing
View Details
CPNE4 AAV Vector (Mouse) (CMV)
16762104 1 µg

CPNE4 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
N-myc Downstream Regulated Gene 1 Protein, NT (NDRG1, NDR1, Protein NDRG1, CAP43, Differentiation-related Gene 1 Protein, CMT4D, DRG1, DRG-1, GC4, HMSNL, Nickel-specific Induction Protein Cap43, NMSL, Reducing Agents and Tunicamycin-responsive Protein, RT
MBS6490215-01 0.1 mL

N-myc Downstream Regulated Gene 1 Protein, NT (NDRG1, NDR1, Protein NDRG1, CAP43, Differentiation-related Gene 1 Protein, CMT4D, DRG1, DRG-1, GC4, HMSNL, Nickel-specific Induction Protein Cap43, NMSL, Reducing Agents and Tunicamycin-responsive Protein, RT

Sign In for Pricing
View Details
N-myc Downstream Regulated Gene 1 Protein, NT (NDRG1, NDR1, Protein NDRG1, CAP43, Differentiation-related Gene 1 Protein, CMT4D, DRG1, DRG-1, GC4, HMSNL, Nickel-specific Induction Protein Cap43, NMSL, Reducing Agents and Tunicamycin-responsive Protein, RT
MBS6490215-02 5x 0.1 mL

N-myc Downstream Regulated Gene 1 Protein, NT (NDRG1, NDR1, Protein NDRG1, CAP43, Differentiation-related Gene 1 Protein, CMT4D, DRG1, DRG-1, GC4, HMSNL, Nickel-specific Induction Protein Cap43, NMSL, Reducing Agents and Tunicamycin-responsive Protein, RT

Sign In for Pricing
View Details
Anti-CTLA4 Antibody Picoband®
A00020-1 100 µg/Vial

Anti-CTLA4 Antibody Picoband®

Sign In for Pricing
View Details