Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3D Rabbit Polyclonal Antibody (HRP)

EIF3D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF3S7, eIF3-p66, eIF3-zeta

UniProt

O15371

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003744

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taf2 3'UTR GFP Stable Cell Line
TU170103 1.0 mL

Taf2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CSN1S2A 3'UTR Luciferase Stable Cell Line
TU005109 1.0 mL

CSN1S2A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TIMP4 Antibody (HRP)
orb238612-01 50 µg

TIMP4 Antibody (HRP)

Sign In for Pricing
View Details
TIMP4 Antibody (HRP)
orb238612-02 100 µg

TIMP4 Antibody (HRP)

Sign In for Pricing
View Details
UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6, GNT1, HLUGP, HLUGP1, MGC29860, UDPGT, UGT1, UGT1A6S, UGT1F) (PE)
253258-PE 100 µL

UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6, GNT1, HLUGP, HLUGP1, MGC29860, UDPGT, UGT1, UGT1A6S, UGT1F) (PE)

Sign In for Pricing
View Details
RAB1B (Ras-related protein Rab-1B) (PE)
132168-PE 100 µL

RAB1B (Ras-related protein Rab-1B) (PE)

Sign In for Pricing
View Details