Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3D Rabbit Polyclonal Antibody (HRP)

EIF3D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF3S7, eIF3-p66, eIF3-zeta

UniProt

O15371

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003744

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100366004 3'UTR GFP Stable Cell Line
TU259721 1.0 mL

LOC100366004 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CDC25C, phosphorylated (Ser216)
521280-01 100 µL

CDC25C, phosphorylated (Ser216)

Sign In for Pricing
View Details
CDC25C, phosphorylated (Ser216)
521280-02 200 µL

CDC25C, phosphorylated (Ser216)

Sign In for Pricing
View Details
Ankrd43 3'UTR GFP Stable Cell Line
TU250655 1.0 mL

Ankrd43 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human CAPZA3 sgRNA gene knockout kit - Lentiviral human CAPZA3 sgRNA gene knockout kit (plasmid)
GTR15368183 1 Vial

Lentiviral human CAPZA3 sgRNA gene knockout kit - Lentiviral human CAPZA3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HOXD10 Antibody
orb20012 100 µg

HOXD10 Antibody

Sign In for Pricing
View Details