Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G5B Rabbit Polyclonal Antibody (FITC)

LY6G5B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G5b, C6orf19

UniProt

Q8NDX9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_067044

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO6 Antibody, HRP conjugated
CSB-PA008840LB01HU-01 50 μL

FOXO6 Antibody, HRP conjugated

Sign In for Pricing
View Details
FOXO6 Antibody, HRP conjugated
CSB-PA008840LB01HU-02 100 µL

FOXO6 Antibody, HRP conjugated

Sign In for Pricing
View Details
Bad, phosphorylated (Ser134) (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) (MaxLight 750) discontinued
B0003-47M-ML750 100 µL

Bad, phosphorylated (Ser134) (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SR 1664
256740-01 10 mg

SR 1664

Sign In for Pricing
View Details
SR 1664
256740-02 50 mg

SR 1664

Sign In for Pricing
View Details
TIE1 (Tyrosine-protein Kinase Receptor Tie-1, TIE, JTK14) (Biotin)
134440-Biotin 100 µL

TIE1 (Tyrosine-protein Kinase Receptor Tie-1, TIE, JTK14) (Biotin)

Sign In for Pricing
View Details