Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytip Rabbit Polyclonal Antibody (Biotin)

Cytip Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cb, Cbp, Cyb, Psc, Cybr, C80816, Pscdbp, AI462064, A130053M09Rik

UniProt

Q91VY6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Cytip

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_631939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AAK1 (AP2-associated protein kinase 1) ELISA Kit
MBS7608153-01 48 Well

Human AAK1 (AP2-associated protein kinase 1) ELISA Kit

Sign In for Pricing
View Details
Human AAK1 (AP2-associated protein kinase 1) ELISA Kit
MBS7608153-02 96 Well

Human AAK1 (AP2-associated protein kinase 1) ELISA Kit

Sign In for Pricing
View Details
Human AAK1 (AP2-associated protein kinase 1) ELISA Kit
MBS7608153-03 5x 96 Well

Human AAK1 (AP2-associated protein kinase 1) ELISA Kit

Sign In for Pricing
View Details
Human AAK1 (AP2-associated protein kinase 1) ELISA Kit
MBS7608153-04 10x 96 Well

Human AAK1 (AP2-associated protein kinase 1) ELISA Kit

Sign In for Pricing
View Details
1-[4- (Difluoromethyl) -6- (1-ethyl-3-methyl-1H-pyrazol-4-yl) pyrimidin-2-yl]piperidin-4-amine
XWB39377-01 50 mg

1-[4- (Difluoromethyl) -6- (1-ethyl-3-methyl-1H-pyrazol-4-yl) pyrimidin-2-yl]piperidin-4-amine

Sign In for Pricing
View Details
1-[4- (Difluoromethyl) -6- (1-ethyl-3-methyl-1H-pyrazol-4-yl) pyrimidin-2-yl]piperidin-4-amine
XWB39377-02 0.5 g

1-[4- (Difluoromethyl) -6- (1-ethyl-3-methyl-1H-pyrazol-4-yl) pyrimidin-2-yl]piperidin-4-amine

Sign In for Pricing
View Details