Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytip Rabbit Polyclonal Antibody (HRP)

Cytip Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cb, Cbp, Cyb, Psc, Cybr, C80816, Pscdbp, AI462064, A130053M09Rik

UniProt

Q91VY6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Cytip

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_631939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Enterobacteria phage f1 Attachment protein G3P (III)
orb2925179-01 20 µg

Recombinant Enterobacteria phage f1 Attachment protein G3P (III)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage f1 Attachment protein G3P (III)
orb2925179-02 100 µg

Recombinant Enterobacteria phage f1 Attachment protein G3P (III)

Sign In for Pricing
View Details
GSK8612, TBK1 inhibitor (highly selective)
TBI4693-25MG 25 mg

GSK8612, TBK1 inhibitor (highly selective)

Sign In for Pricing
View Details
FNBP1 Protein Vector (Mouse) (pPM-C-HA)
PV179892 500 ng

FNBP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rat GCSFR (Colony Stimulating Factor Receptor, Granulocyte) ELISA Kit
ER0983 96 Tests

Rat GCSFR (Colony Stimulating Factor Receptor, Granulocyte) ELISA Kit

Sign In for Pricing
View Details
Mouse anti-Human CD56, FITC Conjugated mAb
MBS8504188-01 50 Tests

Mouse anti-Human CD56, FITC Conjugated mAb

Sign In for Pricing
View Details