Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASL11B Rabbit Polyclonal Antibody (Biotin)

RASL11B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC2827, MGC4499

UniProt

Q9BPW5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076429

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ugt1a1 Antibody Picoband®, Dylight594 Conjugate
A01865-2-Dylight594 100 µg

Anti-Ugt1a1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
NRSN1 Rabbit Polyclonal Antibody (BF555)
orb2539623 100 µL

NRSN1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
RBP4 (RBP-4, Retinol Binding Protein 4) (MaxLight 550)
MBS6264671-01 0.1 mL

RBP4 (RBP-4, Retinol Binding Protein 4) (MaxLight 550)

Sign In for Pricing
View Details
RBP4 (RBP-4, Retinol Binding Protein 4) (MaxLight 550)
MBS6264671-02 5x 0.1 mL

RBP4 (RBP-4, Retinol Binding Protein 4) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r194 shRNA (UAS) - Lentiviral mouse Vmn1r194 shRNA (UAS, iRFP) (100)
GTR15199611 1 Vial

Lentiviral mouse Vmn1r194 shRNA (UAS) - Lentiviral mouse Vmn1r194 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Kuwanon T
M38946-01 100 mg

Kuwanon T

Sign In for Pricing
View Details