Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL1 Rabbit Polyclonal Antibody (FITC)

TTLL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C22orf7, HS323M22B

UniProt

O95922

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TTLL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP (Lung Resistance-Related Protein) Rabbit ELISA Kit
E7477 96 Tests

LRP (Lung Resistance-Related Protein) Rabbit ELISA Kit

Sign In for Pricing
View Details
ABL2 Rabbit Polyclonal Antibody (PE-Cy7)
orb917675 100 µL

ABL2 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
MERTK Polyclonal Antibody
MBS9127695-01 0.02 mL

MERTK Polyclonal Antibody

Sign In for Pricing
View Details
MERTK Polyclonal Antibody
MBS9127695-02 0.1 mL

MERTK Polyclonal Antibody

Sign In for Pricing
View Details
MERTK Polyclonal Antibody
MBS9127695-03 5x 0.1 mL

MERTK Polyclonal Antibody

Sign In for Pricing
View Details
PHIP (BD1), Recombinant, Human, aa1146-1287, His-Tag (Bromodomain Pleckstrin Homology Domain Interacting Protein, IRS-1 PH Domain-Binding Protein, WDR11, BRWD2)
298447 100 µg

PHIP (BD1), Recombinant, Human, aa1146-1287, His-Tag (Bromodomain Pleckstrin Homology Domain Interacting Protein, IRS-1 PH Domain-Binding Protein, WDR11, BRWD2)

Sign In for Pricing
View Details