Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C18orf1 Rabbit Polyclonal Antibody (HRP)

C18orf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C18orf1

UniProt

O15165

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_852146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myeloperoxidase Recombinant Rabbit monoclonal Antibody
HA723674 100 µL

Human Myeloperoxidase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700726 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human HLA-DR Antibody[L243]
E-AB-F1111J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human HLA-DR Antibody[L243]
E-AB-F1111J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human HLA-DR Antibody[L243]
E-AB-F1111J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL
BNC742409-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details