Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf15 Rabbit Polyclonal Antibody (HRP)

C3orf15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AAT1, MAATS1, SPGF51, C3orf15, CaM-IP2, SPATA26, AAT1alpha

UniProt

Q7Z4T9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQLTTTDASFQMPKE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_203528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precu
MBS6254247-01 0.1 mL

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precu

Sign In for Pricing
View Details
Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precu
MBS6254247-02 5x 0.1 mL

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precu

Sign In for Pricing
View Details
Human CD9 Antibody , PE
E55A10399 50 Tests

Human CD9 Antibody , PE

Sign In for Pricing
View Details
TBX15 3'UTR GFP Stable Cell Line
TU075254 1.0 mL

TBX15 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
IL10 Antibody
E30AC532 100 µL

IL10 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Influenza A H1N1 M1 Antibody (02) [DyLight 755]
NBP3-06633IR 0.1 mL

Mouse Monoclonal Influenza A H1N1 M1 Antibody (02) [DyLight 755]

Sign In for Pricing
View Details