Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf15 Rabbit Polyclonal Antibody (HRP)

C3orf15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AAT1, MAATS1, SPGF51, C3orf15, CaM-IP2, SPATA26, AAT1alpha

UniProt

Q7Z4T9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQLTTTDASFQMPKE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_203528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tab2 ELISA Kit
ELI-51985r 96 Tests

Rat Tab2 ELISA Kit

Sign In for Pricing
View Details
Zirconium (IV) 2,2,6,6-tetramethylheptane-3,5-dionate
IN5732 1 Each

Zirconium (IV) 2,2,6,6-tetramethylheptane-3,5-dionate

Sign In for Pricing
View Details
Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit
RDR-ESAM-Hu-01 96 Tests

Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit

Sign In for Pricing
View Details
Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit
RDR-ESAM-Hu-02 48 Tests

Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit

Sign In for Pricing
View Details
CXCL1 (GRO/KC) (MaxLight 490)
G8975-24A-ML490 100 µL

CXCL1 (GRO/KC) (MaxLight 490)

Sign In for Pricing
View Details
SPATA9 Blocking Peptide
33R-2943 0.1 mg

SPATA9 Blocking Peptide

Sign In for Pricing
View Details