Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALN1 Rabbit Polyclonal Antibody (HRP)

CALN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CABP8

UniProt

Q9BXU9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CALN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_113656

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMPR1A (Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Serine/Threonine-protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, CD292, ACVRLK3, ALK3) (APC) discontinued
B2553-62G 100 Tests

BMPR1A (Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Serine/Threonine-protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, CD292, ACVRLK3, ALK3) (APC) discontinued

Sign In for Pricing
View Details
GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864) (FITC)
MBS6379882-01 0.1 mL

GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864) (FITC)

Sign In for Pricing
View Details
GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864) (FITC)
MBS6379882-02 5x 0.1 mL

GLRX3 (Glutaredoxin-3, PKC-interacting Cousin of Thioredoxin, PICOT, PKC-theta-interacting Protein, PKCq-interacting Protein, Thioredoxin-like Protein 2, TXNL2, HUSSY-22, bA500G10.4, FLJ11864) (FITC)

Sign In for Pricing
View Details
Lentiviral human MPPED1 shRNA (UAS) - Lentiviral human MPPED1 shRNA (UAS, iRFP) plasmid
GTR15306847 1 Vial

Lentiviral human MPPED1 shRNA (UAS) - Lentiviral human MPPED1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
14-3-3 Rabbit pAb, Pacific Blue conjugated
orb2827009 100 µL

14-3-3 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Anti-Human LYPD3 Antibody (SAA0109)
HF831107 100 µg

Anti-Human LYPD3 Antibody (SAA0109)

Sign In for Pricing
View Details