Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTPS2 Rabbit Polyclonal Antibody (HRP)

CTPS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp686C17207, FLJ43358, MGC32997

UniProt

Q9NRF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_787055

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine secretory immunoglobulin A, SIgA ELISA Kit
MBS1609631 96 Well

Bovine secretory immunoglobulin A, SIgA ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SPATS2 Antibody [DyLight 650]
NBP2-97797C 0.1 mL

Rabbit Polyclonal SPATS2 Antibody [DyLight 650]

Sign In for Pricing
View Details
ZNF330 (NM_014487) Human 3' UTR Clone
SC209278 10 µg

ZNF330 (NM_014487) Human 3' UTR Clone

Sign In for Pricing
View Details
Caspase 9 protein
MBS5304395-01 0.05 mg

Caspase 9 protein

Sign In for Pricing
View Details
Caspase 9 protein
MBS5304395-02 5x 0.0 5mg

Caspase 9 protein

Sign In for Pricing
View Details
MYO1B Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62726R-BF488 100 µL

MYO1B Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details