Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM167A Rabbit Polyclonal Antibody (HRP)

FAM167A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

D8S265, C8orf13, DIORA-1

UniProt

Q96KS9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM167A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_444509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA11 Rabbit Polyclonal Antibody (BF680)
orb2398786 100 µL

HOXA11 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
PURA Antibody - middle region
MBS3223631-01 0.1 mL

PURA Antibody - middle region

Sign In for Pricing
View Details
PURA Antibody - middle region
MBS3223631-02 5x 0.1 mL

PURA Antibody - middle region

Sign In for Pricing
View Details
Human GPR87 shRNA Plasmid
abx959990-01 150 µg

Human GPR87 shRNA Plasmid

Sign In for Pricing
View Details
Human GPR87 shRNA Plasmid
abx959990-02 300 µg

Human GPR87 shRNA Plasmid

Sign In for Pricing
View Details
Acetoacetyl Coenzyme A Synthetase (AACS), Recombinant, Human, His-Tag
051639-01 10 µg

Acetoacetyl Coenzyme A Synthetase (AACS), Recombinant, Human, His-Tag

Sign In for Pricing
View Details