Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL38 Rabbit Polyclonal Antibody (FITC)

MRPL38 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L38MT, RPML3, MRP-L3, HSPC262, MRP-L38

UniProt

Q96DV4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL38

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YIFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115867

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Maml1 shRNA (UAS) - Lentiviral mouse Maml1 shRNA (UAS, RFP) (25)
GTR15214583 1 Vial

Lentiviral mouse Maml1 shRNA (UAS) - Lentiviral mouse Maml1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PNCC Antibody
A77930-100UL 100 µL

PNCC Antibody

Sign In for Pricing
View Details
Lentiviral human ATP6V1B2 sgRNA gene knockout kit - Lentiviral human ATP6V1B2 sgRNA gene knockout kit (plasmid)
GTR15393365 1 Vial

Lentiviral human ATP6V1B2 sgRNA gene knockout kit - Lentiviral human ATP6V1B2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri psd Protein (aa 1-255) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
VAng-Lsx9675-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri psd Protein (aa 1-255) (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Sign In for Pricing
View Details
Lentiviral human ABHD12B shRNA (UAS) - Lentiviral human ABHD12B shRNA (UAS) (100)
GTR15079578 1 Vial

Lentiviral human ABHD12B shRNA (UAS) - Lentiviral human ABHD12B shRNA (UAS) (100)

Sign In for Pricing
View Details
CD20 (MS4A1) Mouse Monoclonal Antibody [Clone ID: B9E9]
AM50217PU-S 100 µg

CD20 (MS4A1) Mouse Monoclonal Antibody [Clone ID: B9E9]

Sign In for Pricing
View Details