Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL38 Rabbit Polyclonal Antibody (HRP)

MRPL38 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L38MT, RPML3, MRP-L3, HSPC262, MRP-L38

UniProt

Q96DV4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL38

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YIFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115867

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP4A siRNA (Human)
CRH2434-01 15 nmol

INPP4A siRNA (Human)

Sign In for Pricing
View Details
INPP4A siRNA (Human)
CRH2434-02 30 nmol

INPP4A siRNA (Human)

Sign In for Pricing
View Details
Lentiviral mouse Cdh13 shRNA (UAS) - Lentiviral mouse Cdh13 shRNA (UAS, iRFP) plasmid
GTR15203008 1 Vial

Lentiviral mouse Cdh13 shRNA (UAS) - Lentiviral mouse Cdh13 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
5- (Chloromethyl) quinoline hydrochloride
YKC19436-01 50 mg

5- (Chloromethyl) quinoline hydrochloride

Sign In for Pricing
View Details
5- (Chloromethyl) quinoline hydrochloride
YKC19436-02 0.5 g

5- (Chloromethyl) quinoline hydrochloride

Sign In for Pricing
View Details
GPR146, ID (GPR146, PGR8, Probable G-protein coupled receptor 146, G-protein coupled receptor PGR8) (AP)
MBS6303733-01 0.2 mL

GPR146, ID (GPR146, PGR8, Probable G-protein coupled receptor 146, G-protein coupled receptor PGR8) (AP)

Sign In for Pricing
View Details