Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA6 Rabbit Polyclonal Antibody (HRP)

NDUFA6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B14, LYRM6, CI-B14, MC1DN33, NADHB14

UniProt

P56556

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002481

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp407 sgRNA CRISPR Lentivector set (Mouse)
K4876101 3x 1.0 µg

Zfp407 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
SKF38393 HCl
S7993-50mg 50 mg

SKF38393 HCl

Sign In for Pricing
View Details
SPG33 Antibody
E301123 100 µg - 200 µL

SPG33 Antibody

Sign In for Pricing
View Details
Bovine Interleukin-17A ELISA Kit
MBS9425043-01 96 Tests

Bovine Interleukin-17A ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin-17A ELISA Kit
MBS9425043-02 5x 96 Tests

Bovine Interleukin-17A ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal IL-6R alpha Antibody (17506) [DyLight 550]
FAB227L 0.1 mL

Mouse Monoclonal IL-6R alpha Antibody (17506) [DyLight 550]

Sign In for Pricing
View Details