Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA6 Rabbit Polyclonal Antibody (HRP)

NDUFA6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B14, LYRM6, CI-B14, MC1DN33, NADHB14

UniProt

P56556

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002481

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gna13 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4434602 1.0 µg DNA

Gna13 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
WM-100-124-BK-PK Adhesive-backed Marker Combination Packs
111756 625 Pack (25 Label (s) x 25 Card)

WM-100-124-BK-PK Adhesive-backed Marker Combination Packs

Sign In for Pricing
View Details
CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 550)
MBS6467027-01 0.1 mL

CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 550)

Sign In for Pricing
View Details
CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 550)
MBS6467027-02 5x 0.1 mL

CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) (MaxLight 550)

Sign In for Pricing
View Details
DGCR6L antibody - C-terminal region
MBS3215002-01 0.1 mL

DGCR6L antibody - C-terminal region

Sign In for Pricing
View Details
DGCR6L antibody - C-terminal region
MBS3215002-02 5x 0.1 mL

DGCR6L antibody - C-terminal region

Sign In for Pricing
View Details