Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Rabbit Polyclonal Antibody (Biotin)

RPA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

REPA2, RPA32, RP-A p32, RP-A p34

UniProt

O76021

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_056474

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87)
N0570-25N 200 µL

NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87)

Sign In for Pricing
View Details
Rabbit anti-CD133 Antibody
MBS4507377-01 0.05 mL

Rabbit anti-CD133 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD133 Antibody
MBS4507377-02 0.1 mL

Rabbit anti-CD133 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD133 Antibody
MBS4507377-03 5x 0.1 mL

Rabbit anti-CD133 Antibody

Sign In for Pricing
View Details
Olfr342 Protein Vector (Mouse) (pPM-C-His)
PV210205 500 ng

Olfr342 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rat Col14a1 Pre-designed siRNA Set A
SI203044A 1 Each

Rat Col14a1 Pre-designed siRNA Set A

Sign In for Pricing
View Details