Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Rabbit Polyclonal Antibody (HRP)

RPA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

REPA2, RPA32, RP-A p32, RP-A p34

UniProt

O76021

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_056474

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDI2 (NM_033261) Human Recombinant Protein
TP304632M 100 µg

IDI2 (NM_033261) Human Recombinant Protein

Sign In for Pricing
View Details
Human DLGAP1 activation kit by CRISPRa
GA106154 1 Kit

Human DLGAP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Uncoated Mouse CFH (Complement Factor H) ELISA Kit
E-UNEL-M0025-01 5x 96 Tests

Uncoated Mouse CFH (Complement Factor H) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse CFH (Complement Factor H) ELISA Kit
E-UNEL-M0025-02 15x 96 Tests

Uncoated Mouse CFH (Complement Factor H) ELISA Kit

Sign In for Pricing
View Details
CDX1 Human Gene Knockout Kit (CRISPR)
KN420111 1 Kit

CDX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ceramide glucosyltransferase (UGCG) Human Gene Knockout Kit (CRISPR)
KN206288 1 Kit

Ceramide glucosyltransferase (UGCG) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details