Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRPG Rabbit Polyclonal Antibody (HRP)

SIRPG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD172g, SIRPB2, SIRP-B2, bA77C3.1, SIRPgamma

UniProt

O75131

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAART

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_003900

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ebf1 shRNA (UAS) - Lentiviral mouse Ebf1 shRNA (UAS, RFP) (25)
GTR15176843 1 Vial

Lentiviral mouse Ebf1 shRNA (UAS) - Lentiviral mouse Ebf1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Protocadherin gamma-C3 (PCDHGC3) Human ELISA Kit
G4783 96 Tests

Protocadherin gamma-C3 (PCDHGC3) Human ELISA Kit

Sign In for Pricing
View Details
Anti-Gbp4 Antibody Picoband®, Cy3 Conjugate
A11011-3-Cy3 100 µg/Vial

Anti-Gbp4 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Anti-BRAF Antibody
STJ500282 100 µg

Anti-BRAF Antibody

Sign In for Pricing
View Details
Nuclear Receptor Coactivator 3 (NCOA3) Magnetic Luminex Assay Kit
LKU604040 96 Tests

Nuclear Receptor Coactivator 3 (NCOA3) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
11β-HSD1L Double Nickase Plasmid (h)
sc-409104-NIC 20 µg

11β-HSD1L Double Nickase Plasmid (h)

Sign In for Pricing
View Details