Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRPG Rabbit Polyclonal Antibody (HRP)

SIRPG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD172g, SIRPB2, SIRP-B2, bA77C3.1, SIRPgamma

UniProt

O75131

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAART

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_003900

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR5619 Mouse MicroRNA Expression Plasmid (MI0019187)
SC402648 10 µg

MIR5619 Mouse MicroRNA Expression Plasmid (MI0019187)

Sign In for Pricing
View Details
RND1 (NM_014470) Human Recombinant Protein
TP305535L 1 mg

RND1 (NM_014470) Human Recombinant Protein

Sign In for Pricing
View Details
DLAT (Dihydrolipoyl Transacetylase) BioAssayTM ELISA Kit (Mouse) discontinued
355284-01 48 Tests

DLAT (Dihydrolipoyl Transacetylase) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
DLAT (Dihydrolipoyl Transacetylase) BioAssayTM ELISA Kit (Mouse) discontinued
355284-02 96 Tests

DLAT (Dihydrolipoyl Transacetylase) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
DCP2 Rabbit Polyclonal Antibody
E10G02599 100 µL

DCP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LPP CRISPR/Cas9 KO Plasmid (h2)
sc-406769-KO-2 20 µg

LPP CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details