Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc11 Rabbit Polyclonal Antibody (HRP)

Dnajc11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E030019A03Rik

UniProt

Q5U458

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIIEAEESRMGLIIVNAWYGKFVNDKSRKNEKVKVIDVTVPLQCLVKDSK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dram Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV810687 1.0 µg DNA

Dram Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2050895-01 0.1 mL

FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2050895-02 0.2 mL

FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2050895-03 0.5 mL

FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2050895-04 1 mL

FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2050895-05 5 mL

FITC-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details