Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

O3FAR1 Rabbit Polyclonal Antibody (HRP)

O3FAR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GT01, PGR4, BMIQ10, GPR120, GPR129, O3FAR1

UniProt

Q5NUL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF740 conjugate, 0.1mg/mL
BNC742243-500 1x 500 µL

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
T4 DNA Ligase, 20000U
ME4304 20000 U

T4 DNA Ligase, 20000U

Sign In for Pricing
View Details
P73 (Tumor Suppressor) (P73/2531), CF488A conjugate, 0.1mg/mL
BNC882531-500 1x 500 µL

P73 (Tumor Suppressor) (P73/2531), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (MHC II) (DA2), CF568 conjugate, 0.1mg/mL
BNC682281-500 1x 500 µL

HLA-DRB (MHC II) (DA2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant GABA B Receptor 1 Monoclonal Antibody
AN301934L-01 50 µL

Recombinant GABA B Receptor 1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GABA B Receptor 1 Monoclonal Antibody
AN301934L-02 100 µL

Recombinant GABA B Receptor 1 Monoclonal Antibody

Sign In for Pricing
View Details