Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZC3H12A Rabbit Polyclonal Antibody (HRP)

ZC3H12A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Reg1, MCPIP, MCPIP1, MCPIP-1, dJ423B22.1

UniProt

P82912

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLT

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_789775

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BP1 Antibody [Alexa Fluor 700]
NB100-481AF700 0.1 mL

Rabbit Polyclonal BP1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
VSTM2A Human Over-expression Lysate
orb1375052 20 µg

VSTM2A Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse X-Ray Repair Cross Complementing 6 (XRCC6) ELISA Kit
EKN49357 96 Tests

Mouse X-Ray Repair Cross Complementing 6 (XRCC6) ELISA Kit

Sign In for Pricing
View Details
(3alpha,5beta,7beta)-Cholane-3,7,24-triol-d5
TRC-C292532-25MG 25 mg

(3alpha,5beta,7beta)-Cholane-3,7,24-triol-d5

Sign In for Pricing
View Details
Canine Calmodulin-regulated spectrin-associated protein 2 (CAMSAP1L1) ELISA Kit
MBS7252788-01 48 Well

Canine Calmodulin-regulated spectrin-associated protein 2 (CAMSAP1L1) ELISA Kit

Sign In for Pricing
View Details
Canine Calmodulin-regulated spectrin-associated protein 2 (CAMSAP1L1) ELISA Kit
MBS7252788-02 96 Well

Canine Calmodulin-regulated spectrin-associated protein 2 (CAMSAP1L1) ELISA Kit

Sign In for Pricing
View Details