Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTFR1 Rabbit Polyclonal Antibody (FITC)

MTFR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CHPPR, FAM54A2

UniProt

Q9NRX1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti Mouse Cd13 Monoclonal Antibody,RPE
CABT-45558RM 100 TEST

Rat Anti Mouse Cd13 Monoclonal Antibody,RPE

Sign In for Pricing
View Details
Polyclonal IRE1p Antibody
APR06380G 0.1 mg

Polyclonal IRE1p Antibody

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2081780-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2081780-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2081780-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2081780-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details