Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTFR1 Rabbit Polyclonal Antibody (HRP)

MTFR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CHPPR, FAM54A2

UniProt

Q9NRX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPPED2, CT (MPPED2, C11orf8, FAM1B, Metallophosphoesterase MPPED2, Fetal brain protein 239, Metallophosphoesterase domain-containing protein 2) (MaxLight 550)
MBS6321984-01 0.1 mL

MPPED2, CT (MPPED2, C11orf8, FAM1B, Metallophosphoesterase MPPED2, Fetal brain protein 239, Metallophosphoesterase domain-containing protein 2) (MaxLight 550)

Sign In for Pricing
View Details
MPPED2, CT (MPPED2, C11orf8, FAM1B, Metallophosphoesterase MPPED2, Fetal brain protein 239, Metallophosphoesterase domain-containing protein 2) (MaxLight 550)
MBS6321984-02 5x 0.1 mL

MPPED2, CT (MPPED2, C11orf8, FAM1B, Metallophosphoesterase MPPED2, Fetal brain protein 239, Metallophosphoesterase domain-containing protein 2) (MaxLight 550)

Sign In for Pricing
View Details
APC2 Rabbit Polyclonal Antibody (HRP)
orb478850 100 µL

APC2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Wdtc1 shRNA (UAS) - Lentiviral mouse Wdtc1 shRNA (UAS, RFP) (100)
GTR15177996 1 Vial

Lentiviral mouse Wdtc1 shRNA (UAS) - Lentiviral mouse Wdtc1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Hsa-miR-4525 miRNA Agomir
orb1920203-01 5 nmol

Hsa-miR-4525 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4525 miRNA Agomir
orb1920203-02 10 nmol

Hsa-miR-4525 miRNA Agomir

Sign In for Pricing
View Details