Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STN1 Rabbit Polyclonal Antibody (HRP)

STN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AAF44, OBFC1, AAF-44, RPA-32, bA541N10.2

UniProt

Q9H668

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079204

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHISAL2A (NM_001042693) Human Recombinant Protein
TP322378M 100 µg

SHISAL2A (NM_001042693) Human Recombinant Protein

Sign In for Pricing
View Details
Multi-Well Plates
DP35UR-9-N 100 Units/Case

Multi-Well Plates

Sign In for Pricing
View Details
Ndufs4 Recombinant Rabbit Monoclonal Antibody [JE40-47]
ET7109-09 100 µL

Ndufs4 Recombinant Rabbit Monoclonal Antibody [JE40-47]

Sign In for Pricing
View Details
4,4'-Dithiobisbenzoic Acid, Technical Grade
TRC-D494200-5G 5 g

4,4'-Dithiobisbenzoic Acid, Technical Grade

Sign In for Pricing
View Details
C10orf92 (CFAP46) Human Gene Knockout Kit (CRISPR)
KN435394 1 Kit

C10orf92 (CFAP46) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714051 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details