Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STN1 Rabbit Polyclonal Antibody (HRP)

STN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AAF44, OBFC1, AAF-44, RPA-32, bA541N10.2

UniProt

Q9H668

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079204

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQGAP1 Mouse Monoclonal Antibody [Clone ID: OTI5F9]
CF809922 100 µg

IQGAP1 Mouse Monoclonal Antibody [Clone ID: OTI5F9]

Sign In for Pricing
View Details
ASTL (NM_001002036) Human Over-expression Lysate
LC424175 20 µg

ASTL (NM_001002036) Human Over-expression Lysate

Sign In for Pricing
View Details
Amplite® Fluorimetric Glutathione Peroxidase Assay Kit *Blue Fluorescence*
11560-AAT 200 Tests

Amplite® Fluorimetric Glutathione Peroxidase Assay Kit *Blue Fluorescence*

Sign In for Pricing
View Details
IL-1 beta Recombinant Rabbit monoclonal Antibody
HA723965 100 µL

IL-1 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF594 conjugate, 0.1mg/mL
BNC943803-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant GBP1 Antibody
RC-5723-01 50 μL

Recombinant GBP1 Antibody

Sign In for Pricing
View Details